PDA

Archiv verlassen und diese Seite im Standarddesign anzeigen : Grösste Workunits



ApuXteu
12.11.2003, 20:06
Meine Workunits bishzer hatten so 250 bis 500 Einheiten. Jetzt hab ich eine mit 2500(!!!) - das dauert echt schon ewig. Das muss dann fett Punkte geben :) Was waren eure grössten?

Sir Ulli
12.11.2003, 21:14
ich habe bis jetzt WUs in der grössenordnung von 250-500 bekommen.

MFG
Sir Ulli

Heretic
13.11.2003, 12:27
100 oder 400 Frames

Ausserdem ..... http://folding.stanford.edu/psummary.html
da steht keine WU mit 2500 Frames .... isses evtl. ein Genome@home?

ApuXteu
13.11.2003, 17:49
nein - ich hab nur folding at home eingestellt. und ich hab 2500 frames - das ist ganz eindeutig. und in der grafik wird auch so ein dingens angezeigt wie sonst auch

ApuXteu
13.11.2003, 17:50
p356_A21nat_273_94

Sir Ulli
13.11.2003, 18:07
Original geschrieben von ApuXteu
p356_A21nat_273_94

hat aber laut der Folding Seite sogar 6426 Atome, und es gibt ja auch noch viel grössere.

MFG
Sir Ulli

ApuXteu
13.11.2003, 20:07
Ich hoffe Credit 51,40 bedeutet nicht, daß ich nur so wenige Punkte bekomme. Immerhin Rechne ich 5 mal so lang als an dern ersten WU´s

Heretic
14.11.2003, 07:10
die 51.40 sind die Punkte, die du bekommen wirst, japp. Aber wieso stehen bei dem Projekt nur 100 Frames, wenns doch angeblich 2500 sind?
btw: die Anzahl der Atome und die der Frames sind was völlig verschiedenes ;)

ApuXteu
14.11.2003, 09:08
Ich verstehs auch nicht. Ich hab da jetzt 2 Tage dran rumgerechnet. Das waren wirklich 2500 Frames. Und bekommen hab ich wirklich nur die paar Punkte. Im Grunde ists egal, weil ich meine Rechenzeit ja für was sinnvolles zur verfügung stellen möchte - aber trotzdem hätte ich gern die entsprechenden Punkte bekommen :)

TiKu
14.11.2003, 09:38
2 Tage geht doch noch. Ich habe auch grad eine, die ca. 35 Stunden dauert. Solche Dinger hatte ich schon oft.

Heretic
14.11.2003, 12:06
Bei mir erkennt der Client nicht immer die 3DNow!-Fähigkeit meines Athlon XP .... ihr solltet, wenn eine neue WU startet bzw. wenn F@H startet ma in's Log des Konsolenclient schauen, da steht das dabei (evtl. muss man den verbose mode anschalten)


[06:01:53] Writing local files
[06:01:54] Extra 3DNow boost OK. <--
[06:01:54] Writing local files

Steht niggs da, wird es vom Prozessor auch net genutzt ... Folge: eure WU dauert bis zu 5 (!) mal so lange.

man kann den Client mit der -forceasm option auch zwingen, die Optimierungen zu nutzen, bei mir nimmt er dann allerdings SSE statt 3Dnow!, was sich in ein paar Sekunden mehr pro Frame wiederspiegelt. Meistens hilft aber ein Restart des Clients, da dann erneut nach dem 3Dnow! gesucht wird

PuckPoltergeist
14.11.2003, 13:28
Hm, also bei mir sehe ich nichts dergleichen. Weder mit noch ohne -forceasm. Egal wie oft ich den client neu starte.

ApuXteu
15.11.2003, 23:38
Scheisse jetzt hab ich wieder so ein fettes Ding. Es ist schon nervig, daß ich für die 5fache arbeit die gleichen Punkte bekomm. Das ist ja genauso schlimm wie bei dem Krebs Projekt bei dem man weniger Punkte bekommt weil man ein AMD System hat.

Heretic
17.11.2003, 00:06
versucht mal -verbosity 9 (für zusätzliche Anzeigen) und -avsmethod (damit bekommt ihr mehr WUs, die versuchen, die prozessorspezifischen Erweiterungen zu nutzen)

PuckPoltergeist
17.11.2003, 13:03
Verbosity auf 9 zu setzen hat auch keinen Unterschied gemacht. -advmethods habe ich jetzt mal angegeben, aber bei der aktuellen WU hat das keinen Unterschied gemacht.

Heretic
17.11.2003, 15:35
-advmethods wirkt auch erst, wenn du eine neue WU bekommst, weil es die Art der WU beeinflusst, die du vom Server bekommst

PuckPoltergeist
17.11.2003, 17:05
Ah ja, also mal schauen. Die aktuelle dauert noch ein paar Stunden.

CapJo
18.11.2003, 08:29
Ich bin seit gestern mit 2 Rechnern XP 1700 und PII 700 dabei. Die Clients auf beiden Rechnern haben WU mit 2500 Frames bekommen.

Beide Clients haben zum gleichen Zeitpunkt angefangen zu rechnen nur der PIII 700 ist mit 2 % in Vorsprung gegangen. Ist die Workunit die am XP1700 läuft sehr viel komplexer als die vom PIII 700 oder ist die Optimierung für den XP so schlecht?

Die Optimierung für beide Prozessoren läuft. PIII ISSE Bost und XP 3DNow! Bost.

Heretic
18.11.2003, 11:52
Nach einem kurzen Test scheint der SSE Boost fast doppelt so schnell zu sein (3DNow!: ~18 min /SSE: ~10 min) ... jedenfalls bei meiner aktuellen WU

starte den Client mit -forceasm auf dem Athlon XP einfach mal neu

CapJo
18.11.2003, 15:01
Dass ein alter PIII 700 mit SSE scheller ist als mein XP 1700 mit 3DNow! ist ja schon etwas heftig. Ich hab auch im Forum gelesen, dass der XP in der nächsten Version von F@H standardmäßig mit SSE laufen soll. Es gibt laut Forum aber das Problem, dass nicht jedes XP-System SSE unterstützt und deshalb laufen alle AMD CPUs derzeit mit 3DNow!. SSE sollte jedoch schneller sein *buck*

Die fehlende SSE unterstützung soll aufgrund fehlerhafter BIOS-Programmierung zustande kommen, aber so genau weiss ich das jetzt auch nicht.

Um zu testen ob die CPU richtig und fehlerfrei SSE unterstützt gibt es ein kleines Programm von einem Moderator von F@H TheWeatherMan.

http://forum.folding-community.org/viewtopic.php?p=37695

Auf seiner Homepage findet man auch weitere Tools für F@H z. B. Electron Microscope III

http://home.comcast.net/~wxdude1/emsite/download.html

Ich hab auch noch etwas intessantes über -advmethods, -forceasm, and Overclocking gefunden.

http://forum.folding-community.org/viewtopic.php?t=6057&highlight=xp+sse

Sam_Samiliar
18.11.2003, 15:52
Also mein system läuft zwar stabil , sowohl nach prime als auch nach dem sse tester aber 1. dauert eine wu bei mir ewig und dann bricht er des öfteren zwischen durch einfach ab ... wos is da jetzt der fehler ? So macht das nicht wirklich spass ...

CapJo
18.11.2003, 16:03
Mit SSE läuft mein XP 1700 jetzt deutlich schneller !!!

@Sam_Samiliar

Im moment weis ich nich wo der Fehler bei dir liegt. Wie bricht es denn ab und was für eine CPU hast du und wie lange läuft bei dir F@H?

PuckPoltergeist
18.11.2003, 16:04
Original geschrieben von PuckPoltergeist
Hm, also bei mir sehe ich nichts dergleichen. Weder mit noch ohne -forceasm. Egal wie oft ich den client neu starte.

Ok, "Fehler" gefunden. Der Linux-Client bekommt z.Z. nur Tinker-Units, auf Grund eines Fehlers bei der Berechnung. Ob -advmethods daran was ändert werde ich bei der nächsten Unit sehen.

Desti
18.11.2003, 18:21
Original geschrieben von PuckPoltergeist
Ok, "Fehler" gefunden. Der Linux-Client bekommt z.Z. nur Tinker-Units, auf Grund eines Fehlers bei der Berechnung. Ob -advmethods daran was ändert werde ich bei der nächsten Unit sehen.

Was sind denn diese TINKER?
Ich hab die auch nur, bis auf eine, das war was anderes *noahnung* :]

PuckPoltergeist
18.11.2003, 18:25
Es gibt Tinker- und Gromacs-units. Die genauen Unterschiede weiß ich auch nicht, da mußt du im FaH-Forum suchen. Wichtig ist, daß Gromacs-units SSE-beschleunigt sind. Tinker's haben dies nicht.

TiKu
18.11.2003, 18:51
Die Gromacs-WUs sind für den neuesten der verschiedenen F@H-Cores (FahCore_78). Dieser Core kann erstmals auch SSE und 3DNow! nutzen. Die Tinker-WUs sind dagegen noch für einen älteren Core gedacht (ich glaube FahCore_75).

Wenn also mal eine WU dabei ist, die kein SSE/3DNow! nutzt, liegt das wahrscheinlich daran, dass sie noch über den Tinker-Core läuft. Das Flag -advmethods (oder war's -forceasm?) führt vermutlich dazu, dass man hauptsächlich WUs für den Gromacs-Core bekommt.

PuckPoltergeist
18.11.2003, 18:59
Also die Tinker, die bei mir gerade läuft, nutzt ./FahCore_65.exe.

TiKu
18.11.2003, 19:02
Stimmt, muss FahCore_65 heißen.

PuckPoltergeist
18.11.2003, 19:07
Naja, hätte ja auch sein können, daß da noch eine zwischen geschoben wurde. Ich bin ja jetzt echt auf die nächste unit gespannt. Habe jetzt auch FAH4.00 laufen.

DigitalRaven
18.11.2003, 19:30
ich benutz den normalen graphics-client und in der log file wird das 3dnow! auch nicht erwähnt. kann man das vielleicht irgendwo nachträglich einschalten? und haben die WUs deadlines? :confused:

Desti
18.11.2003, 19:37
Also ich hatte bisher nur 1x so eine:

10:19:51] Loaded queue successfully.
[10:19:51] + Benchmarking ...
[10:20:00] The benchmark result is 2870
[10:20:00] - Autosending finished units...
[10:20:00] Trying to send all finished work units
[10:20:00] + Sent 0 completed units to the server
[10:20:00] - Autosend completed
[10:20:00]
[10:20:00] + Processing work unit
[10:20:00] Core required: FahCore_ca.exe
[10:20:00] Core found.
[10:20:00] Working on Unit 06 [November 17 10:20:00]
[10:20:00] + Working ...
[10:20:00] - Calling './FahCore_ca.exe -dir work/ -suffix 06 -lifeline 1885
'

[10:20:00] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
[10:20:00]
[10:20:00] Proj: work/wudata_06
[10:20:00] Finding work files
[10:20:00] sizeof(CORE_PACKET_HDR) = 512
[10:20:01] Checking frame files
[10:20:01] Restarting from checkpointed files.
[10:20:01]
[10:20:01] Protein: Des2/pdb1qto.34.spa
[10:20:01] - Frames Completed: 340, Remaining: 260
[10:20:01] - Dynamic steps required: 52000
[10:20:01]
[10:20:02] Printed current.prm
[10:20:02] Writing local files:
[10:20:02] - Writing "work/wudata_06.key": (overwrite)successful.
[10:20:02] - Writing "work/wudata_06.xyz": (overwrite)successful.
[10:20:02] - Writing "work/wudata_06.prm": (overwrite)successful.
[10:20:03] Starting design engine
[10:20:03] [SPG] project name: work/wudata_06.
[10:20:03] [SPG] 2 2
[10:20:03] [SPG] Initializing protein design engine
[10:20:03] [SPG] seed = 14597052
[10:20:03] [SPG] Initialization complete
[10:20:03] [SPG] Writing current.pdb, chainlength = 122
[10:20:03] [SPG] Writing current.xyz
[10:20:03] [SPG] Preprocessing . . .
[10:20:03] [SPG] 122 positions in protein
[10:21:41] [SPG] Preprocessing complete
[10:21:41] Iterations: 340 of 600
[10:21:42] Finished
[10:21:42] [SPG] Native chi angles stored
[10:21:44] [SPG] Rotamers read
[10:21:44] [SPG] Starting genetic algorithm
[10:23:31] [SPG] seed: 262746936
[10:23:31] [SPG] Designing protein sequence 18 of 30
[10:27:32] [SPG] 10.0 %
[10:31:22] [SPG] 20.0 %
[10:35:01] [SPG] 30.0 %
[10:38:28] [SPG] 40.0 %
[10:41:55] [SPG] 50.0 %
[10:45:19] [SPG] 60.0 %
[10:48:43] [SPG] 70.0 %
[10:52:04] [SPG] 80.0 %
[10:55:24] [SPG] 90.0 %
[10:58:40] [SPG] 100.0 %
[10:58:40] [SPG] Writing current.xyz
[10:58:41] [SPG] Sequence 18 completed:
[10:58:41] TSTEKVETYELYSKEVKALAAFLVEYMGYAEKTGNEKYMKVYWNNQTLVM . . .
[10:58:41] Iterations: 360 of 600
[10:58:42] Finished
[10:58:42] [SPG] seed: 277343988
[10:58:42] [SPG] Designing protein sequence 19 of 30
[11:02:42] [SPG] 10.0 %
[11:06:28] [SPG] 20.0 %
[11:10:03] [SPG] 30.0 %
[11:13:32] [SPG] 40.0 %
[11:16:54] [SPG] 50.0 %
[11:20:13] [SPG] 60.0 %
[11:23:26] [SPG] 70.0 %
[11:26:33] [SPG] 80.0 %
[11:29:33] [SPG] 90.0 %
[11:32:36] [SPG] 100.0 %
[11:32:36] [SPG] Writing current.xyz
[11:32:37] [SPG] Sequence 19 completed:
[11:32:37] ETSSDSEMYKFYSPSVPNAIQLLISYYGFEKKKGYERFAMVAQSKFAMMV . . .
[11:32:37] Iterations: 380 of 600
[11:32:38] Finished
blablabla




sonst immer


[18:38:33] Loaded queue successfully.
[18:38:33] + Benchmarking ...
[18:38:42] The benchmark result is 2846
[18:38:42] - Autosending finished units...
[18:38:42] Trying to send all finished work units
[18:38:42] + Sent 0 completed units to the server
[18:38:42] - Autosend completed
[18:38:42]
[18:38:42] + Processing work unit
[18:38:42] Core required: FahCore_65.exe
[18:38:42] Core found.
[18:38:42] Working on Unit 02 [November 18 18:38:42]
[18:38:42] + Working ...
[18:38:42] - Calling './FahCore_65.exe -dir work/ -suffix 02 -lifeline 4556
'

[18:38:42] Folding@Home Client Core Version 2.50 (August 19, 2002)
[18:38:42]
[18:38:42] Proj: work/wudata_02
[18:38:42] Done: 22922 -> 142974 (decompressed 623.7 percent)
[18:38:42] nsteps: 5000000 dt: 2.000000 dt_dump: 250.000000 temperature: 355.000000
[18:38:42] xyzfile:
[18:38:42] " 393 p678_L939_K12M_355K
[18:38:42] 1 N 31.222047 63.996598 44.312439 2..."
[18:38:42] keyfile:
[18:38:42] "parameters ./proj678.prm
[18:38:42] NOVERSION
[18:38:42] ARCHIVE
[18:38:42]
[18:38:42] cutoff 16.0
[18:38:42] taper 12...."
[18:38:42]
[18:38:42] Hashes matched on file work/wudata_02.dyn
[18:38:42] ARC file integrity verified
[18:38:42] Restarting from checkpointed files.
[18:38:42]
[18:38:42] Protein: p678_L939_K12M_355K
[18:38:42] - Run: 2 (Clone 32, Gen 13)
[18:38:42] - Frames Completed: 311, Remaining: 89
[18:38:42] - Dynamic steps required: 1112500
[18:38:42]
[18:38:42] Writing local files:
[18:38:42]
[18:38:42] parameters work/wudata_02.prm
[18:38:42] - Writing "work/wudata_02.key": (overwrite) successful.
[18:38:42] - Writing "work/wudata_02.xyz": (overwrite) successful.
[18:38:42] - Writing "work/wudata_02.prm": (overwrite) successful.
[18:38:43] - Writing "work/wudata_02.key": (append) successful.
[18:38:43]
[18:38:43] PROJECT="work/wudata_02", NSTEPS=1112500, DT=2.0000, DTDUMP=25.000000, TEMP=355.00
[18:38:44] TINKER: Software Tools for Molecular Design
[18:38:44] Version 3.8 October 2000
[18:38:44] Copyright (c) Jay William Ponder 1990-2000
[18:38:44] portions Copyright (c) Michael Shirts 2001
[18:38:44] portions Copyright (c) Vijay S Pande 2001




*noahnung* *noahnung* *noahnung*

Desti
18.11.2003, 19:43
Interessant:

http://forum.folding-community.org/viewtopic.php?t=6309

http://forum.folding-community.org/viewtopic.php?t=6288

PuckPoltergeist
18.11.2003, 19:46
Original geschrieben von Desti
Interessant:

http://forum.folding-community.org/viewtopic.php?t=6309

http://forum.folding-community.org/viewtopic.php?t=6288

Darauf bezog ich mich bei meinem ""Fehler" gefunden".

Zu den deadlines: http://www.stanford.edu/group/pandegroup/folding/psummary.html

TiKu
18.11.2003, 19:51
Original geschrieben von DigitalRaven
ich benutz den normalen graphics-client und in der log file wird das 3dnow! auch nicht erwähnt. kann man das vielleicht irgendwo nachträglich einschalten? und haben die WUs deadlines? :confused: Wie gesagt: SSE und 3DNow! werden nur mit dem Gromacs-Core genutzt. Schau mal nach, ob Du vll. bisher nur Tinker-WUs erwischt hast.
Und ja, die WUs haben Deadlines. Die ist aber von Protein zu Protein unterschiedlich. Hier (http://folding.stanford.edu/psummary.html) gibt's eine Übersicht. Die Deadline schwankt also zwischen 6 und 50 Tagen.

Sam_Samiliar
18.11.2003, 20:11
Original geschrieben von CapJo
Mit SSE läuft mein XP 1700 jetzt deutlich schneller !!!

@Sam_Samiliar

Im moment weis ich nich wo der Fehler bei dir liegt. Wie bricht es denn ab und was für eine CPU hast du und wie lange läuft bei dir F@H?

Also er bricht ab mir der meldung ready to send results (oder wies halt heißt wenn er results senden will den genauen wortlaut weiß ich jetzt auch nicht) und dann läd er sich ne neue runter . Cpu wäre ein Athlon XP2500+ und laufen tuts bei mir im optimum 14h am tag.
Und mit SSE bekomm ich im log auch nix angezeigt , 3dnow aber auch nicht :/

CapJo
18.11.2003, 20:36
Test mal mit dem Tool ob bei dir SSE auch funktioniert.

http://home.comcast.net/~wxdude1/emsite/download/stresscpu.zip

Sam_Samiliar
18.11.2003, 20:46
wie oben beschrieben funzt das tool bei mir ohne probleme ... im momen läufts auch wieder ...

Schpock
19.11.2003, 07:58
das ist ja hammerkrass, hab jetzt auch mal zum testen SSE erzwungen und die bruchstücke dauern nu nichtmehr 20 min sondern 8 !!! das ist ja ne frecheit ;D

CapJo
19.11.2003, 08:08
Ich hab jetzt auch eine Tinker-WU bekommen die unter mit der FahCore_65 ohne SSE oder 3DNow! läuft. Das ganze dauert 48 Stunden gibt 70,9 Punke.

Die Gromac-Core brigen mehr Score :]

Sam_Samiliar
19.11.2003, 11:06
Original geschrieben von Schpock
das ist ja hammerkrass, hab jetzt auch mal zum testen SSE erzwungen und die bruchstücke dauern nu nichtmehr 20 min sondern 8 !!! das ist ja ne frecheit ;D

wie kann ich denn SSE erzwingen ? und woran kann ich sehn das ich erfolgreich war ?

CapJo
19.11.2003, 11:29
Du musst deinen Client mit dem Parameter -forceasm starten. Danach sollte dein XP SSE benutzen. Einfach -forceasm an die Verknüpfung zum Client dranhängen.

SSE kann jedoch nur mit Gromacs-Workunits benutzt werden. Für Tinker-WUs gibt es keine Unterstützung für SSE oder 3DNow!.

Du kannst das alles in der Log nachlesen !!! Rechtsklick About -> Log

Sam_Samiliar
19.11.2003, 11:34
[10:33:15] Writing local files
[10:33:15] Completed 750000 out of 2500000 steps (30)
[10:33:15] Extra SSE boost OK.

unglaublich , es geht , ich hoff das ganze mache jetzt mal n bisschen mehr speed, dangge für die hilfe !

PuckPoltergeist
19.11.2003, 12:21
Bei Gromacs sollte er automatisch die Beshcleunigung nutzen. Habe mir jetzt mit -advmethods auch eine Gromacs erschlichen und er hat 3DNow! aktiviert. Mit -forceSSE (bei Version3 noch -forceasm) habe ich ihn jetzt mal zu SSE gezwungen. Mal schauen, was schneller ist. ;D

edit: Also mit SSE ist er bei mir wirklich schneller, wobei er jetzt keine timered checkpoints mehr triggerd. *noahnung*

Heretic
19.11.2003, 14:16
Hab auch mal den 4er Client getestet, is ein schönes Feature mit den Checkpoints
Bei mir werden sie übrigens auch mit -forceSSE getriggert .....

PuckPoltergeist
19.11.2003, 14:51
[11:26:28] (Starting from checkpoint)
[11:26:28] Protein: p1034_A21nat_305_99
[11:26:28]
[11:26:28] Writing local files
[11:26:28] Completed 140996 out of 2500000 steps (5%)
[11:26:28] Extra SSE boost OK.
[11:31:03] Writing local files
[11:31:05] Completed 150000 out of 2500000 steps (6%)
[11:43:07] Timered checkpoint triggered.
[11:43:42] Writing local files
[11:43:44] Completed 175000 out of 2500000 steps (7%)
[11:55:34] Writing local files
[11:55:36] Completed 200000 out of 2500000 steps (8%)
[12:07:32] Writing local files
[12:07:34] Completed 225000 out of 2500000 steps (9%)
[12:19:18] Writing local files
[12:19:20] Completed 250000 out of 2500000 steps (10%)
[12:31:22] Timered checkpoint triggered.
[12:31:55] Writing local files
[12:31:57] Completed 275000 out of 2500000 steps (11%)
[12:43:59] Timered checkpoint triggered.
[12:46:51] Writing local files
[12:46:53] Completed 300000 out of 2500000 steps (12%)
[12:58:37] Writing local files
[12:58:39] Completed 325000 out of 2500000 steps (13%)
[13:10:05] Writing local files
[13:10:07] Completed 350000 out of 2500000 steps (14%)
[13:22:07] Writing local files
[13:22:09] Completed 375000 out of 2500000 steps (15%)
[13:33:22] Writing local files
[13:33:24] Completed 400000 out of 2500000 steps (16%)
[13:44:37] Writing local files
[13:44:39] Completed 425000 out of 2500000 steps (17%)
[13:56:25] Writing local files
[13:56:27] Completed 450000 out of 2500000 steps (18%)


Bei mir also auch noch, nur bei weitem nicht mehr so oft. Bei 3DNow! kam das bei jedem Prozent. :o

Heretic
19.11.2003, 15:22
mach ma -config .... da kannste das einstellen (hab aber kA, inwiefern das -forceSSE darauf einfluss hat, ich hab 3 min eingestellt und er triggert ca. aller 2:30 min)

Edit: wenn ich mir dein Log anseh, der triggert immer 12 min nach dem letzten CP bzw. dem letzten fertigen Frame (was durchaus sinnvoll ist ..), also keine Sorge

PuckPoltergeist
20.11.2003, 14:23
Sorgen mache ich mir auch keine. ;)

Hab jetzt wieder ohne -advmethods aufgerufen und prompt wieder eine Tinker bekommen. Naja gut, ich werde die Gromacs jetzt auch nicht erzwingen. Die Tinker müssen ja auch weg. ;D

CapJo
20.11.2003, 14:49
Wenn du die Cosolenversion in der 4er Version mit einem falschen Parameter aufrufst steht eine bessere Beschreibung zu den ganzen Parametern drinnen.

Bei -advmethods steht da, dass du nur noch "optimierte" WUs bekommst. Also hoffentlich keine Tinker mehr. Also bei allen XPs -forceSSE und bei allen CPUs mit SSE oder 3DNow! -advmethods rein dann flutschen die WUs schneller.

PuckPoltergeist
20.11.2003, 17:04
Wozu? Die Tinker-Units müssen auch gerechnet werden.

CapJo
20.11.2003, 19:09
Die Tinker-Units sollen CPUs rechnen die kein SSE oder 3DNow! unterstützen. Vor allem weil man für die Tinker-Units im Gegensatz zu den Gromacs-WUs einfach zu wenig Punkte bekommt und wir wollen doch weiter nach oben in die Rangliste.

Das Punkte-System ist eh sehr unausgewogen. Die Prüfen WUs mit einem Celeron 500 ohne SS oder 3DNow!. Bei den Gromacs WUs kann jedoch SSE oder 3DNow! benutzt werden und so bekommt einige an Punkte innerhalb kurzer Zeit. Bei Tinker-Units kann weder 3DNow! noch SSE genutzt werden und deine CPU rechnet trotz der "sinnvollen" Erweiterungen diese WUs mit roher Gewalt aus, was sehr lange dauert und damit nur wenig Punkte bringt.

Wie soll man jedoch die Punkte verteilen? Das Punktesystem dient doch dazu den Wettbewerb unter den "Hilfskräften" anzukurbeln und somit möglichst viele WUs zu berechnen, damit man die daraus gewonnen Daten nutzen kann. Wieso bekommt man mit einem langsameren PC weniger Punkte? Natürlich werden viele sagen, da er einfach weniger WUs innerhalb eines Zeitraums berechnen kann. CPUs mit Erweiterungen sind bei geeigneter Software auch schneller als CPUs ohne. Wenn man jedoch einem User Software ohne SSE,3DNow! gibt obwohl seine CPU dies unterstützt "bestraft" man ihn doch im Vergleich zu einem User dessen CPU diese Erweiterungen nicht unterstützt. Das alles geschieht aber für einen "sinnvollen" Zweck und die Macher sollten die WUs verteilen, dass möglichst viel berechnet werden kann.

Das ist meine Ansicht und das ganze Bewertungssystem ist schon etwas "philosophisch". Der Sinn und Zweck ist es jedoch möglichst viele Menschen zu bewegen bei diesem Projekt mitzumachen.

Außerdem verschwendet man damit Rechenleistung da die Erweiterungen einfach brachliegen. Vielleichten sollten die auch eine optimierte Version für P4 und eine verbesserte 3DNow! optimierung rausbrigen. Die SSE-Optimierung scheint um längen besser zu sein als 3DNow!. Ein alter P3 700 rechnet schneller als mein XP 1700 mit 3Dnow!. Nach der Umstellung meines XP 1700 auf SSE war er auf einmal doppelt so schnell wie der P3 700. Vielleicht ist auch möglich DUAL-CPU-Systeme besser zu unterstützen.

Das alles ist mit Programmieraufwand verbunden, bringt jedoch bei gleichbleibender Hardware deutlich mehr Leistung was man an dem Beispiel von SSE deutlich sieht.

PuckPoltergeist
20.11.2003, 20:19
Also meine Tinker haben bis jetzt immer mehr Punkte abgeworfen als die Gromacs. Gut, dafür dauern sie auch länger. Aber wenn du davon ausgehst, wieviele CPUs ohne die Erweiterungen fliegen denn noch im Produktivbetrieb rum?

edit: Ok, Gromacs bringt pro Zeit trotzdem mehr Punkte (bei mir).

CapJo
20.11.2003, 20:58
Man muss auf jeden Fall das Bewertungssystem ändern!

Die sollen ihre Tinker- und Gromacs-WUs mit einer CPU die SSE/3DNow! Benchen und für die benötigte Zeit Punkte vergeben. Ältere CPUs ohne Erweitrungen sind bei Tinker-WUs damit gleichstark, bei Gromacs-WUs sind sie dann aber deutlich schlechter, was eigenlich auf völlig gerechtfertigt sein sollte da diese CPUs einfach älter sind und langsamer. Oder zu meiner vorherigen Frage warum bekommt eine höher getaktete CPU mehr Punkte?

Man sollte jedoch trotzdem darauf achten, dass CPUs mit Erweiterungen auch solche WUs bekommen.

TiKu
20.11.2003, 21:30
Ach Leute, die Bewertung ist doch im Grunde egal, oder? Ich schaue zwar auch mindestens 1x täglich in die Stats, aber wirklich wichtig ist mir meine Platzierung nicht.
Ob ich bei der Bewertung benachteiligt werde oder nicht, spielt für mich kaum eine Rolle, da ich so oder so versuche, das beste aus meinem Rechner rauszuholen und andere Rechner zu assimilieren.

TiKu (der wo noch immer an seiner letzten CP-WU rechnet und somit erst in ca. 2 Wochen richtig bei F@H loslegen wird)

CapJo
20.11.2003, 21:39
Wenn die Bewertung so egal ist wieso bringt P3DNow! ne Meldung, dass CP schon auf Platz 10 ist? Ich hab ja schon geschrieben, dass sich die Wertungssystem Schwung und Wettbewerb in diesen Bereich bringt und somit neue User anregt hier mitzumachen und gemeinsam "ganz nach oben" zu kommen. Ein sinnvolles und gerechtes Bewertungssystem fördert gerade diesen Zustand!

PuckPoltergeist
20.11.2003, 21:49
Womit wir wieder bei der Frage wären, was ein gerechtes Bewertungssystem ist. Fakt ist, daß Tinker und Gromacs sehr verschieden arbeiten und sich verdammt schlecht vergleichen lassen.

TiKu
20.11.2003, 21:52
Original geschrieben von CapJo
Wenn die Bewertung so egal ist wieso bringt P3DNow! ne Meldung, dass CP schon auf Platz 10 ist?Um neue Member zu werben. Das würde ich genauso machen. Ist wie im Mediamarkt mit den "echten 3 GHz".
Das klingt jetzt paradox, aber mir geht es beim Crunchen eher um das Gemeinsame. Ich sehe es gerne, wenn die Community wächst und alle für eine Sache (die wissenschaftliche, nicht die statistische) arbeiten. Was da so nebenbei rauskommt (z. B. eine gute Platzierung) ist mir persönlich relativ Wurst, ich nutze das maximal als Werbemittel (weil ich weiß, dass andere da mehr Wert drauflegen).

Alle Klarheiten beseitigt? *g*

DigitalRaven
23.11.2003, 00:33
habe heute meine erste gromacs-wu bekommen und gleich mal sse erzwungen-->11 min/punkt :D
und was die deadlines angeht: unter "queue info" steht bei mir jetzt "november 22 21.02.22|january 1 21.02". die tinker unit hatte das verfallsdatun noch nicht angegeben,was ein service :o

nachtrag: mit 3dnow!-->14min/punkt

Sam_Samiliar
23.11.2003, 15:17
kann mir mal bitte einer sagen wieso manchmal einfach f@h einfach von slebst auffhört :


[14:07:32] Completed 575000 out of 2500000 steps (23)
[14:15:40] Writing local files
[14:15:42] Completed 600000 out of 2500000 steps (24)
[14:20:31] Gromacs cannot continue further.
[14:20:31] Going to send back what have done.
[14:20:31] logfile size: 25328
[14:20:31] - Writing 25864 bytes of core data to disk...
[14:20:31] ... Done.
[14:20:31]
[14:20:31] Folding@home Core Shutdown: EARLY_UNIT_END
[14:20:35] CoreStatus = 72 (114)
[14:20:35] Sending work to server


is etwas ärgerlich ... :(

TiKu
23.11.2003, 15:53
>AthlonXP 2500+ @ 2420 GHz, FSB 220
Zu stark übertaktet? Das führt manchmal zu Rechenfehlern.
Auf Prime95 (falls Du damit getestet hast) würde ich mich nicht unbedingt verlassen. Schau mal ins CP-Forum. Da findest Du einige Leute, die auf Prime-stabilen Rechnern ständig Eiszeiten ausgerechnet haben und das zweifelsfrei auf's Übertakten zurückführen konnten. CP ist also sensibler als Prime95. Möglicherweise gilt das auch für Folding@Home.

TiKu (bei dem wo noch nie eine F@H-WU abgebrochen wurde)

Sam_Samiliar
23.11.2003, 16:29
Original geschrieben von TiKu
>AthlonXP 2500+ @ 2420 GHz, FSB 220
Zu stark übertaktet? Das führt manchmal zu Rechenfehlern.
Auf Prime95 (falls Du damit getestet hast) würde ich mich nicht unbedingt verlassen. Schau mal ins CP-Forum. Da findest Du einige Leute, die auf Prime-stabilen Rechnern ständig Eiszeiten ausgerechnet haben und das zweifelsfrei auf's Übertakten zurückführen konnten.
Naja wenns wegen instabilen rechner is kommt ne andere fehlermeldung das kenn ich schon ;) deswegen hab ich auch den FSB wieder zurück genommen ... es wundert mich nur etwas das es kam nachdem er stundenlang ohne probleme gerechnet hatte , also irgendwie bezweifel ich das ...

Gast06092012
24.11.2003, 01:54
Daß der Client nicht direkt aufgehört hat zu rechnen könnte daran liegen daß er nicht unmittelbar beim kleinsten Fehler den Dienst quittiert, sondern erst aufhört wenn aufgrund der Fehler keine sinnvollen Ergebnisse mehr errechnet werden können. Hast du deine Temps immer im Auge? Denn das könnte auch die Ursache sein, wenn er eine zeitlang rechnet und die Temps dann irgendwann zu hoch werden.

Sam_Samiliar
24.11.2003, 19:44
Original geschrieben von Buebchen
Daß der Client nicht direkt aufgehört hat zu rechnen könnte daran liegen daß er nicht unmittelbar beim kleinsten Fehler den Dienst quittiert, sondern erst aufhört wenn aufgrund der Fehler keine sinnvollen Ergebnisse mehr errechnet werden können. Hast du deine Temps immer im Auge? Denn das könnte auch die Ursache sein, wenn er eine zeitlang rechnet und die Temps dann irgendwann zu hoch werden.

wie gesagt ich dacht da kommt n eigener fehler aber ich denk ich werd dann moin ma runter gehn auf 2,3 ghz und weniger v-core....

PuckPoltergeist
27.11.2003, 17:12
Original geschrieben von DigitalRaven
habe heute meine erste gromacs-wu bekommen und gleich mal sse erzwungen-->11 min/punkt :D
und was die deadlines angeht: unter "queue info" steht bei mir jetzt "november 22 21.02.22|january 1 21.02". die tinker unit hatte das verfallsdatun noch nicht angegeben,was ein service :o

nachtrag: mit 3dnow!-->14min/punkt

Ich habe mir das nochmal angeschaut. Es ist logisch, daß bei optimaler Programmierung SSE schneller als 3DNow! ist. SSE hat eigene Register, und belegt so nicht die FPU. Die kann also gleichzeitig auch noch rechnen.

DigitalRaven
28.11.2003, 19:43
mir ist was echt fieses aufgefallen. hab ne 2500er wu drin und mein xp 1600+ braucht 36min/punkt. jetzt hab fah mal wieder gestartet und zwar von 18.15 bis 19.45,aber was muß ich sehen?da ist gar nix passiert. der hat zwar die ganze zeit gerechnet aber kein punkt wurde fertiggestellt.hab jetzt fah neu gestartet und hoffe mal,daß er diesmal nicht hängenbleibt *motz*

CapJo
28.11.2003, 19:54
Schau mal im Taskmanager nach welche Core bei dir aktiv ist. Die Bezeichnung lautet FahCore_XX.exe , wobei XX Platzhalter sind.

Dann kannst du noch nachsehen ob SSE aktiv ist. Vielleicht dauert es ja wirklich so lange, da du auch deutlich mehr Punkte für diese WU bekommst, falls es eine Gromacs Unit ist.

DigitalRaven
28.11.2003, 20:01
das prog war schon richtig ausgeführt, also mit fahcore78.exe & 100% cpu-auslastung und hat sich auch ganz normal verhalten.der grafikclient hat auch die rotierenden proteine gezeigt,nix eingefroren etc.....nur, daß eben scheinbar nicht gerechnet wurde -_-

nachtrag: jetzt geht's wieder... *noahnung*

nachtrag 2:sse ist wirklich phänomenal.damit braucht mein betagter 1600+ gerade mal 15min/punkt...mit 3dnow! waren's noch 36min/punkt...warum ist sse so viel besser ???

Zecke
08.01.2004, 14:55
:o 5000 :o ist meine größte WU mit der ich noch am kämpfen bin

hier ein Auszug aus der Logdatei


[20:42:18] Folding@home Gromacs Core
[20:42:18] Version 1.54 (November 26, 2003)
[20:42:18]
[20:42:18] Preparing to commence simulation
[20:42:18] - Assembly optimizations manually forced on.
[20:42:18] - Not checking prior termination.
[20:42:18] - Expanded 48774 -> 279277 (decompressed 572.5 percent)
[20:42:18] - Starting from initial work packet
[20:42:18]
[20:42:18] Project: 257 (Run 23, Clone 72, Gen 0)
[20:42:18]
[20:42:18] Assembly optimizations on if available.
[20:42:18] Entering M.D.
[20:42:24] Protein: p257_RNA_linker2
[20:42:24]
[20:42:24] Writing local files
[20:42:35] Extra SSE boost OK.
[20:42:37] Writing local files
[20:42:39] Completed 0 out of 5000000 steps (0)
[20:53:50] Writing local files
[20:53:52] Completed 50000 out of 5000000 steps (1)

TiKu
08.01.2004, 15:04
Von den Dingern hatte ich schon etliche. ;)

Zecke
08.01.2004, 15:17
Von den 5000 oder 500

zumindest ist das meine erste 5000 WU

MfG Zecke

TiKu
08.01.2004, 18:22
Äh, wie Du meinen?*noahnung* Deine WU besteht aus 5 Mio. Steps. Und solche hatte ich schon oft.
Und von den 5 Mio. sind bei Dir halt 1% (= 50.000) fertig.